PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_17580V3.1.p
Common NamePHYPADRAFT_228394
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 808aa    MW: 91607.9 Da    PI: 5.957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_17580V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.47.8e-14853248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
  Pp3c3_17580V3.1.p  8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53
                       78*****************************.************986 PP

2Myb_DNA-binding31.93.1e-1060103248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          WT eEde+l+++ k++++  W+tI+  +g  Rt+ qc +r+ k+l
  Pp3c3_17580V3.1.p  60 TEWTREEDEKLLHLAKLMPTQ-WRTISPIVG--RTPAQCLERYEKLL 103
                        68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.008257IPR017930Myb domain
SMARTSM007177.0E-15655IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-18960IPR009057Homeodomain-like
PfamPF139213.6E-131070No hitNo description
CDDcd001671.13E-111053No hitNo description
SuperFamilySSF466896.83E-2133107IPR009057Homeodomain-like
CDDcd116593.81E-3055106No hitNo description
PROSITE profilePS5129415.99358107IPR017930Myb domain
SMARTSM007176.2E-1258105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-1361104IPR009057Homeodomain-like
PfamPF118311.0E-56404652IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKLMPTQ WRTISPIVGR TPAQCLERYE KLLDAACARD ESYEPADDPR  120
KLRPGEIDPN PESKPARPDP VDMDEDEKEM LSEARARLAN TRGKKAKRKA REKQLEEARR  180
LASLQKRREL KAAGIDGRQR RRKQKGIDYN AEIPFEKKPP SGFFEVGQEE RPVEQLQFPT  240
TIEELEGKRR ADIEAQLRKQ DIAANKIAQR KNAPAAVMQV NKLNDPEAVR KRSKLMLPAP  300
QISDAELEEI AKMGYAKDFI EAGSEEGSGV TRALLSNYSR TPMGMTPLQT SQRTPGGKGD  360
AIMMEAENLA RMRATQTPLF GGENPELHPS DFSGVTPKKK DIQTPNPIAT PLRTPSGAAT  420
PLRTPNSVYS MFPKGTPIRD DLHINEGSEM LGSESAKAEK LRQEELRRNL RAALGHLPAP  480
TNEYEILVPQ LPIEEKDDND DIEMDMADAI ALQQKEKEAA ELALWKKQTK VVQRGLPRPP  540
LPAIQALKTT LTLEEDGKNL YVSLIEHADL SIRQEMVALL ENDAAKYPPT EEETVKDKKK  600
GASRTVVAGR PPMDAPPLDD FEEEDINEAS RLIEDEVDYL KGAMGHEDAT LEDYAEARDG  660
CVDDLVYFPT RENFGLISVA STNDRLSALQ YEFENVKKHM EAETRKAVRL EHKLKVLTHG  720
YQVRAETLWR QIEALHKETV TLGTEYECFR ALHSQEQLAA PRRIENLQDA LKEQNDKERT  780
LQLRYENLLV EQENIKGFMR SHDERAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10332242236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185202KRRELKAAGIDGRQRRRK
2198203QRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.24920.0protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001786066.10.0predicted protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA9U5D10.0A9U5D1_PHYPA; Predicted protein
STRINGPP1S641_1V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP39481723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]